RPSBLAST alignment for GI: 254781123 and conserved domain: PRK11264

>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional. Length = 250
 Score = 75.9 bits (187), Expect = 3e-14
 Identities = 62/217 (28%), Positives = 99/217 (45%), Gaps = 36/217 (16%)

Query: 285 LEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLG 344
           +E   + K++  + V+    L +  GE + I+GP+G+GKTTLL+ +    +P+ G I +G
Sbjct: 4   IEVKNLVKKFHGQTVLHGIDLEVKPGEVVAIIGPSGSGKTTLLRCINLLEQPEAGTIRVG 63

Query: 345 TNLKIATIDQKREDIDPDKSLASYLTGSSG--------------------DSLMVRGESR 384
                 TID  R  +   K L   L    G                      ++V+GE +
Sbjct: 64  D----ITIDTARS-LSQQKGLIRQLRQHVGFVFQNFNLFPHRTVLENIIEGPVIVKGEPK 118

Query: 385 HVAGYIKDFLFH----PDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFE 440
             A      L        +  S  + LSGG++ R  +AR LA     ++ DEPT+ LD E
Sbjct: 119 EEATARARELLAKVGLAGKETSYPRRLSGGQQQRVAIARALAMRPEVILFDEPTSALDPE 178

Query: 441 TLDFLERTITQL---QGTILIVSHD----RDFLDRTV 470
            +  +  TI QL   + T++IV+H+    RD  DR +
Sbjct: 179 LVGEVLNTIRQLAQEKRTMVIVTHEMSFARDVADRAI 215