RPSBLAST alignment for GI: 254781123 and conserved domain: PRK11650

>gnl|CDD|183258 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional. Length = 356
 Score = 45.6 bits (109), Expect = 3e-05
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 290 ITKQYD-DRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTG 332
           + K YD    V+K   L +  GE I +VGP+G GK+TLL+++ G
Sbjct: 9   VRKSYDGKTQVIKGIDLDVADGEFIVLVGPSGCGKSTLLRMVAG 52