RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13536

>gnl|CDD|184123 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional. Length = 340
 Score = 84.5 bits (209), Expect = 8e-17
 Identities = 63/218 (28%), Positives = 103/218 (47%), Gaps = 24/218 (11%)

Query: 261 EQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNG 320
           E+K    S  +  +  + S+  + ++   ++K Y D+ VV   S  +  GEC G++GPNG
Sbjct: 20  ERKHQGISEAKASIPGSMST--VAIDLAGVSKSYGDKAVVNGLSFTVASGECFGLLGPNG 77

Query: 321 AGKTTLLKLLTGKIKPDCGFIT-LGTNL---------KIATIDQKREDIDPDKSLASYLT 370
           AGK+T+ +++ G   PD G IT LG  +         +I  + Q  +++D + ++   L 
Sbjct: 78  AGKSTIARMILGMTSPDAGKITVLGVPVPARARLARARIGVVPQ-FDNLDLEFTVRENLL 136

Query: 371 GSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIM 430
                  M   E   V   + +F     +A + +  LSGG K R  +AR L      LI+
Sbjct: 137 VFGRYFGMSTREIEAVIPSLLEFARLESKADARVSDLSGGMKRRLTLARALINDPQLLIL 196

Query: 431 DEPTNDLD-------FETLDFLERTITQLQGTILIVSH 461
           DEPT  LD       +E L    R++     TIL+ +H
Sbjct: 197 DEPTTGLDPHARHLIWERL----RSLLARGKTILLTTH 230