RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13549

>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional. Length = 506
 Score = 42.6 bits (101), Expect = 3e-04
 Identities = 17/36 (47%), Positives = 20/36 (55%)

Query: 117 RIENLSVGQTRCVALMKMLISRPDILILDEPTNHLD 152
            I  LS G  +   L K L+  P ILILDEPT  +D
Sbjct: 402 AIARLSGGNQQKAVLAKCLLLNPKILILDEPTRGID 437