RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13632

>gnl|CDD|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 271
 Score = 61.9 bits (151), Expect = 4e-10
 Identities = 51/189 (26%), Positives = 88/189 (46%), Gaps = 23/189 (12%)

Query: 295 DDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL-GTNLKIATID 353
            +   +K+ S  I+ GE + I+G NG+GK+T+ K+LTG +KP  G I + G  +    + 
Sbjct: 20  SENNALKNVSFEINEGEYVAILGHNGSGKSTISKILTGLLKPQSGEIKIDGITISKENLK 79

Query: 354 QKREDI-----DPDKSLASYLTGSSGD-----SLMVRGESRHVAGYIKDFLFHPDQAHSL 403
           + R+ I     +PD    +   G++ +      L  +         I D L         
Sbjct: 80  EIRKKIGIIFQNPD----NQFIGATVEDDIAFGLENKKVPPKKMKDIIDDLAKKVGMEDY 135

Query: 404 MKH----LSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG----T 455
           +      LSGG+K R  +A VLA     +I DE T+ LD +    +++ +  L+     T
Sbjct: 136 LDKEPQNLSGGQKQRVAIASVLALNPEIIIFDESTSMLDPKGKREIKKIMVDLRKTRKKT 195

Query: 456 ILIVSHDRD 464
           ++ ++HD D
Sbjct: 196 LISITHDMD 204