RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13634

>gnl|CDD|184194 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 290
 Score = 40.0 bits (94), Expect = 0.002
 Identities = 20/59 (33%), Positives = 33/59 (55%)

Query: 297 RLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQK 355
           R  + D ++ I  G  + I+G  G+GK+TLL+ L G ++P  G +T+G  +  A    K
Sbjct: 20  RRALYDVNVSIPSGSYVAIIGHTGSGKSTLLQHLNGLLQPTSGTVTIGERVITAGKKNK 78