RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13635

>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 279
 Score = 78.1 bits (193), Expect = 6e-15
 Identities = 63/204 (30%), Positives = 100/204 (49%), Gaps = 29/204 (14%)

Query: 284 VLEADKITKQYDD--RLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFI 341
           ++  + I+ +Y D     +KD S  ++ GE + IVG NG+GK+TL KLL G + P+ G I
Sbjct: 5   IIRVEHISFRYPDAATYALKDVSFSVYEGEWVAIVGHNGSGKSTLAKLLNGLLLPEAGTI 64

Query: 342 TL-GTNLKIATIDQKREDI-----DPDKS---------LASYL--TGSSGDSLMVRGESR 384
           T+ G  L   T+   R  +     +PD           +A  L   G   + ++ R +  
Sbjct: 65  TVGGMVLSEETVWDVRRQVGMVFQNPDNQFVGATVQDDVAFGLENIGVPREEMVERVDQA 124

Query: 385 HVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD----FE 440
                ++DFL    + H     LSGG+K R  +A VLA   + +I+DE T+ LD     E
Sbjct: 125 LRQVGMEDFLNR--EPH----RLSGGQKQRVAIAGVLALQPDIIILDEATSMLDPRGRRE 178

Query: 441 TLDFLERTITQLQGTILIVSHDRD 464
            L+ + +   Q   T+L ++HD D
Sbjct: 179 VLETVRQLKEQKGITVLSITHDLD 202