RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13637

>gnl|CDD|184197 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 287
 Score = 54.3 bits (131), Expect = 9e-08
 Identities = 53/186 (28%), Positives = 90/186 (48%), Gaps = 29/186 (15%)

Query: 300 VKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL------GTNLKIATID 353
           + + ++ I  GE +G++G  G+GK+TL++ L G +KP  G I +         +K++ I 
Sbjct: 23  LDNVNIEIEDGEFVGLIGHTGSGKSTLIQHLNGLLKPTSGKIIIDGVDITDKKVKLSDIR 82

Query: 354 QK-------------REDIDPDKSLASYLTGSSGDSLMVR-GESRHVAGYIKDFLFHPDQ 399
           +K              E I+ D +      G S + +  R   + ++ G   D+  + D+
Sbjct: 83  KKVGLVFQYPEYQLFEETIEKDIAFGPINLGLSEEEIENRVKRAMNIVGL--DYEDYKDK 140

Query: 400 AHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG----T 455
           +      LSGG+K R  +A V+A     LI+DEPT  LD +  D +   I +L      T
Sbjct: 141 SPF---ELSGGQKRRVAIAGVVAMEPKILILDEPTAGLDPKGRDEILNKIKELHKEYNMT 197

Query: 456 ILIVSH 461
           I++VSH
Sbjct: 198 IILVSH 203