RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13640

>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 282
 Score = 58.7 bits (142), Expect = 4e-09
 Identities = 54/204 (26%), Positives = 92/204 (45%), Gaps = 26/204 (12%)

Query: 284 VLEADKITKQYDD--RLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPD---- 337
           ++E   ++  Y D  +  + D S  I  G    ++G NG+GK+T+ KL+ G + PD    
Sbjct: 5   IVEFKHVSFTYPDSKKPALNDISFSIPRGSWTALIGHNGSGKSTISKLINGLLLPDDNPN 64

Query: 338 CGFITLGTNLKIATIDQKREDI-----DPDKSLASYLTGSSGDSLMVRGESRHVA----- 387
                 G  L   T+   RE +     +PD     ++  + GD +    E+R V      
Sbjct: 65  SKITVDGITLTAKTVWDIREKVGIVFQNPDNQ---FVGATVGDDVAFGLENRAVPRPEMI 121

Query: 388 GYIKDFLFH---PDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD----FE 440
             ++D L      D   S   +LSGG+K R  +A +LA     +I+DE T+ LD     +
Sbjct: 122 KIVRDVLADVGMLDYIDSEPANLSGGQKQRVAIAGILAVEPKIIILDESTSMLDPAGKEQ 181

Query: 441 TLDFLERTITQLQGTILIVSHDRD 464
            L  + +   +   T++ ++HD D
Sbjct: 182 ILKLIRKLKKKNNLTVISITHDID 205