RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13646

>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 286
 Score = 44.0 bits (104), Expect = 1e-04
 Identities = 51/188 (27%), Positives = 86/188 (45%), Gaps = 26/188 (13%)

Query: 300 VKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDI 359
           + D +     G+   IVG  G+GK+TL++ +   +KP  G +T+  ++ I T   K + I
Sbjct: 23  IHDVNTEFEQGKYYAIVGQTGSGKSTLIQNINALLKPTTGTVTVD-DITI-THKTKDKYI 80

Query: 360 DPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQ----AHSLMKHL-------- 407
            P +     +       L      R +    K+F  + D+    AH L+  L        
Sbjct: 81  RPVRKRIGMVFQFPESQLFEDTVEREIIFGPKNFKMNLDEVKNYAHRLLMDLGFSRDVMS 140

Query: 408 ------SGGEKMRAI-VARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQ----GTI 456
                 SGG+ MR I +  +LA   + +++DEPT  LD ++   + R +  LQ     TI
Sbjct: 141 QSPFQMSGGQ-MRKIAIVSILAMNPDIIVLDEPTAGLDPQSKRQVMRLLKSLQTDENKTI 199

Query: 457 LIVSHDRD 464
           ++VSHD +
Sbjct: 200 ILVSHDMN 207