RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13647

>gnl|CDD|184206 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 274
 Score = 66.7 bits (163), Expect = 1e-11
 Identities = 60/209 (28%), Positives = 86/209 (41%), Gaps = 37/209 (17%)

Query: 283 LVLEADKITKQY-DDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFI 341
            ++E + +  +Y D    +K  SL I  G    ++GPNGAGK+TLL  L G   P  G +
Sbjct: 3   NIIEVEDLHFRYKDGTKALKGLSLSIPEGSKTALLGPNGAGKSTLLLHLNGIYLPQRGRV 62

Query: 342 T-LGTNLKIATIDQKREDI-----DPDKSLASYLT-----------GSSGDSLMVRGESR 384
             +G  +        R  +     DPD  + S              G   D +  R E  
Sbjct: 63  KVMGREVNAENEKWVRSKVGLVFQDPDDQVFSSTVWDDVAFGPVNMGLDKDEVERRVEEA 122

Query: 385 HVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD------ 438
             A  + DF            HLS G+K R  +A VLA   + +++DEP   LD      
Sbjct: 123 LKAVRMWDF------RDKPPYHLSYGQKKRVAIAGVLAMDPDVIVLDEPMAYLDPRGQET 176

Query: 439 -FETLDFLERTITQLQG-TILIVSHDRDF 465
             E LD L       QG T+++ +HD D 
Sbjct: 177 LMEILDRLHN-----QGKTVIVATHDVDL 200