RPSBLAST alignment for GI: 254781123 and conserved domain: PRK14240

>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional. Length = 250
 Score = 45.1 bits (107), Expect = 6e-05
 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 407 LSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG--TILIVSHD 462
           LSGG++ R  +AR LA     L+MDEPT+ LD  +   +E  I +L+   TI+IV+H+
Sbjct: 147 LSGGQQQRLCIARALAVEPEVLLMDEPTSALDPISTLKIEELIQELKKDYTIVIVTHN 204