RPSBLAST alignment for GI: 254781123 and conserved domain: PRK14250

>gnl|CDD|184591 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional. Length = 241
 Score = 72.5 bits (178), Expect = 3e-13
 Identities = 55/178 (30%), Positives = 92/178 (51%), Gaps = 10/178 (5%)

Query: 295 DDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL-GTNLKIATID 353
             + ++KD S++   G    IVGP+GAGK+TL+KL+   I P  G I + G ++K   + 
Sbjct: 14  FGKEILKDISVKFEGGAIYTIVGPSGAGKSTLIKLINRLIDPTEGSILIDGVDIKTIDVI 73

Query: 354 QKREDIDPDKSLASYLTGSSGDSL----MVRGESR-HVAGYIKDFLFHPDQAHSLMKHLS 408
             R  I           G+  D++    M++GE    V  Y+     + + A   +K+LS
Sbjct: 74  DLRRKIGMVFQQPHLFEGTVKDNIEYGPMLKGEKNVDVEYYLSIVGLNKEYATRDVKNLS 133

Query: 409 GGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG----TILIVSHD 462
           GGE  R  +AR LA     L++DEPT+ LD  + + +E  I +L+     T++ ++H+
Sbjct: 134 GGEAQRVSIARTLANNPEVLLLDEPTSALDPTSTEIIEELIVKLKNKMNLTVIWITHN 191