RPSBLAST alignment for GI: 254781123 and conserved domain: PRK14267

>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional. Length = 253
 Score = 41.4 bits (97), Expect = 6e-04
 Identities = 50/192 (26%), Positives = 79/192 (41%), Gaps = 32/192 (16%)

Query: 16  GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQ-----SGNVFLHSSS-- 68
           G   +++ V L I       L+G +G GKSTLL+    + E        G V L   +  
Sbjct: 15  GSNHVIKGVDLKIPQNGVFALMGPSGCGKSTLLRTFNRLLELNEEARVEGEVRLFGRNIY 74

Query: 69  -----------RLGYLEQNPD-LSHFS-----TISQYIDDTIKDTIEAPYSPYSLLKKFN 111
                       +G + Q P+   H +      I   ++  +K   E        LKK  
Sbjct: 75  SPDVDPIEVRREVGMVFQYPNPFPHLTIYDNVAIGVKLNGLVKSKKELDERVEWALKKAA 134

Query: 112 L------REQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQEL-- 163
           L      R  D   NLS GQ + + + + L  +P IL++DEPT ++D      +E+ L  
Sbjct: 135 LWDEVKDRLNDYPSNLSGGQRQRLVIARALAMKPKILLMDEPTANIDPVGTAKIEELLFE 194

Query: 164 LKINSALIFVSH 175
           LK    ++ V+H
Sbjct: 195 LKKEYTIVLVTH 206