RPSBLAST alignment for GI: 254781123 and conserved domain: PRK15064

>gnl|CDD|185024 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional. Length = 530
 Score = 39.5 bits (93), Expect = 0.003
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 314 GIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQ 354
           G++G NG GK+T +K+L G ++P  G ++L  N ++  + Q
Sbjct: 31  GLIGANGCGKSTFMKILGGDLEPSAGNVSLDPNERLGKLRQ 71