RPSBLAST alignment for GI: 254781123 and conserved domain: COG0444

>gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 316
 Score = 68.7 bits (168), Expect = 5e-12
 Identities = 52/199 (26%), Positives = 81/199 (40%), Gaps = 40/199 (20%)

Query: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFIT------LGTNL----- 347
            V   S  +  GE +GIVG +G+GK+ L K + G +      I        G +L     
Sbjct: 20  AVDGVSFELKKGEILGIVGESGSGKSVLAKAIMGLLPKPNARIVGGEILFDGKDLLSLSE 79

Query: 348 ---------KIATIDQKREDIDPDKSLASYLT--------GSSGDSLMVRGESRHVAGYI 390
                    +IA I Q     DP  SL   +T               + + E++  A  +
Sbjct: 80  KELRKIRGKEIAMIFQ-----DPMTSLNPVMTIGDQIAEVLRLHGKGLSKKEAKERAIEL 134

Query: 391 KDFLFHPDQAHSLMKH---LSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD----FETLD 443
            + +  PD    L  +   LSGG + R ++A  LA     LI DEPT  LD     + LD
Sbjct: 135 LELVGIPDPERRLKSYPHELSGGMRQRVMIAMALALNPKLLIADEPTTALDVTVQAQILD 194

Query: 444 FLERTITQLQGTILIVSHD 462
            L+    +    +++++HD
Sbjct: 195 LLKELQREKGTALILITHD 213