RPSBLAST alignment for GI: 254781123 and conserved domain: COG1116

>gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 248
 Score = 97.2 bits (242), Expect = 1e-20
 Identities = 57/193 (29%), Positives = 91/193 (47%), Gaps = 11/193 (5%)

Query: 282 KLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFI 341
             +LE + ++K +    V++D +L +  GE + I+GP+G GK+TLL+L+ G  KP  G +
Sbjct: 1   MALLEIEGVSKSFGGVEVLEDINLSVEKGEFVAILGPSGCGKSTLLRLIAGLEKPTSGEV 60

Query: 342 TLGTNLKIATIDQKREDIDPDKSLASYLT--GSSGDSLMVRGESRHVAGYIKDFLFH--- 396
            L     +         +  + +L  +LT   +    L +RG+S+  A      L     
Sbjct: 61  LLDGR-PVTGPGPDIGYVFQEDALLPWLTVLDNVALGLELRGKSKAEARERAKELLELVG 119

Query: 397 -PDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFET----LDFLERTITQ 451
                      LSGG + R  +AR LA     L++DEP   LD  T     D L R   +
Sbjct: 120 LAGFEDKYPHQLSGGMRQRVAIARALATRPKLLLLDEPFGALDALTREELQDELLRLWEE 179

Query: 452 LQGTILIVSHDRD 464
            + T+L+V+HD D
Sbjct: 180 TRKTVLLVTHDVD 192