RPSBLAST alignment for GI: 254781123 and conserved domain: COG1118

>gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]. Length = 345
 Score = 98.9 bits (246), Expect = 3e-21
 Identities = 61/212 (28%), Positives = 100/212 (47%), Gaps = 24/212 (11%)

Query: 6   LRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLH 65
           +R++++    G    L D+ L IK  E + L+G +G+GKSTLL+I AG+  P +G + L+
Sbjct: 3   IRINNVKKRFGAFGALDDISLDIKSGELVALLGPSGAGKSTLLRIIAGLETPDAGRIRLN 62

Query: 66  SSS------------RLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSP------YSLL 107
                          ++G++ Q+  L    T++  I   +K   E P           LL
Sbjct: 63  GRVLFDVSNLAVRDRKVGFVFQHYALFPHMTVADNIAFGLKVRKERPSEAEIRARVEELL 122

Query: 108 KKFNLR--EQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLK 165
           +   L          LS GQ + VAL + L   P +L+LDEP   LD +    + + L K
Sbjct: 123 RLVQLEGLADRYPAQLSGGQRQRVALARALAVEPKVLLLDEPFGALDAKVRKELRRWLRK 182

Query: 166 INSAL----IFVSHDRRFLETLSTTTVWLDRG 193
           ++  L    +FV+HD+     L+   V L++G
Sbjct: 183 LHDRLGVTTVFVTHDQEEALELADRVVVLNQG 214