RPSBLAST alignment for GI: 254781123 and conserved domain: COG1119

>gnl|CDD|31316 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]. Length = 257
 Score = 86.8 bits (215), Expect = 1e-17
 Identities = 52/206 (25%), Positives = 87/206 (42%), Gaps = 32/206 (15%)

Query: 1   MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSG 60
           ++ P++ L ++S    G  +L D+   + P E   +VG NG+GK+TLL +  G   P SG
Sbjct: 27  INEPLIELKNVSVRRNGKKILGDLSWQVNPGEHWAIVGPNGAGKTTLLSLLTGEHPPSSG 86

Query: 61  NVFLHSSSRLGYLEQNPDL-SHFSTISQYIDDTIK--------------DTIEAPYSPYS 105
           +V L    R G  E   +L      +S  + +  +               +I       +
Sbjct: 87  DVTLL-GRRFGKGETIFELRKRIGLVSSELHERFRVRETVRDVVLSGFFASIGIYQEDLT 145

Query: 106 ---------LLKKFNL--REQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFR 154
                    LL+             +LS G+ R V + + L+  P++LILDEP   LD  
Sbjct: 146 AEDLAAAQWLLELLGAKHLADRPFGSLSQGEQRRVLIARALVKDPELLILDEPAQGLDLI 205

Query: 155 TIHWMEQELLKINS-----ALIFVSH 175
               +   L ++ +     AL+FV+H
Sbjct: 206 AREQLLNRLEELAASPGAPALLFVTH 231