RPSBLAST alignment for GI: 254781123 and conserved domain: COG1124

>gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 252
 Score = 88.4 bits (219), Expect = 5e-18
 Identities = 58/220 (26%), Positives = 95/220 (43%), Gaps = 33/220 (15%)

Query: 4   PILRLDHISATIGG----IDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQS 59
            +L + ++S   GG       L +V L I+  E + +VG +GSGKSTL ++ AG+ +P S
Sbjct: 2   TLLSVRNLSIVYGGGKFAFHALNNVSLEIERGETLGIVGESGSGKSTLARLLAGLEKPSS 61

Query: 60  GNVFLHSSSRLGYLEQNPDLSHFSTISQYIDD---------TIKDTIEAPYSPYS----- 105
           G++ L          +    + +  +     D         T+   +  P  P+      
Sbjct: 62  GSILLDGKP---LAPKKRAKAFYRPVQMVFQDPYSSLNPRRTVGRILSEPLRPHGLSKSQ 118

Query: 106 -----LLKKFNLRE---QDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIH 157
                LL +  L       R   LS GQ + +A+ + LI  P +LILDEPT+ LD     
Sbjct: 119 QRIAELLDQVGLPPSFLDRRPHELSGGQRQRIAIARALIPEPKLLILDEPTSALDVSVQA 178

Query: 158 WMEQELLKI----NSALIFVSHDRRFLETLSTTTVWLDRG 193
            +   LL++        +F+SHD   +E +      +D G
Sbjct: 179 QILNLLLELKKERGLTYLFISHDLALVEHMCDRIAVMDNG 218