RPSBLAST alignment for GI: 254781123 and conserved domain: COG1131

>gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms]. Length = 293
 Score =  108 bits (270), Expect = 6e-24
 Identities = 57/199 (28%), Positives = 92/199 (46%), Gaps = 14/199 (7%)

Query: 284 VLEADKITKQY-DDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFIT 342
           V+E   +TK+Y  D+  +   S  +  GE  G++GPNGAGKTTLLK+L G +KP  G I 
Sbjct: 4   VIEVRNLTKKYGGDKTALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILAGLLKPTSGEIL 63

Query: 343 LGTNLKIATIDQKREDI---------DPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDF 393
           +     +    + R  I          P+ ++   L   +    + + E+      + + 
Sbjct: 64  VLGYDVVKEPAKVRRRIGYVPQEPSLYPELTVRENLEFFARLYGLSKEEAEERIEELLEL 123

Query: 394 LFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD----FETLDFLERTI 449
               D+A+  ++ LSGG K R  +A  L      LI+DEPT+ LD     E  + L    
Sbjct: 124 FGLEDKANKKVRTLSGGMKQRLSIALALLHDPELLILDEPTSGLDPESRREIWELLRELA 183

Query: 450 TQLQGTILIVSHDRDFLDR 468
            +   TIL+ +H  +  + 
Sbjct: 184 KEGGVTILLSTHILEEAEE 202