RPSBLAST alignment for GI: 254781123 and conserved domain: COG1135

>gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 339
 Score = 84.5 bits (209), Expect = 7e-17
 Identities = 56/220 (25%), Positives = 99/220 (45%), Gaps = 33/220 (15%)

Query: 5   ILRLDHISATI-----GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQS 59
           ++ L+++S T      G +  L DV L I   E   ++G +G+GKSTLL++   +  P S
Sbjct: 1   MIELENVSKTFGQTGTGTVTALDDVSLEIPKGEIFGIIGYSGAGKSTLLRLINLLERPTS 60

Query: 60  GNVFLHS--------------SSRLGYLEQNPDLSHFSTISQ------YIDDTIKDTIEA 99
           G+VF+                  ++G + Q+ +L    T+ +       +    K  I+ 
Sbjct: 61  GSVFVDGQDLTALSEAELRQLRQKIGMIFQHFNLLSSRTVFENVAFPLELAGVPKAEIKQ 120

Query: 100 PYSPYSLLKKFNL--REQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIH 157
             +   LL+   L  +       LS GQ + VA+ + L + P IL+ DE T+ LD  T  
Sbjct: 121 RVAE--LLELVGLSDKADRYPAQLSGGQKQRVAIARALANNPKILLCDEATSALDPETTQ 178

Query: 158 WMEQELLKINSAL----IFVSHDRRFLETLSTTTVWLDRG 193
            + + L  IN  L    + ++H+   ++ +      LD+G
Sbjct: 179 SILELLKDINRELGLTIVLITHEMEVVKRICDRVAVLDQG 218