RPSBLAST alignment for GI: 254781123 and conserved domain: COG3638

>gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258
 Score = 79.1 bits (195), Expect = 4e-15
 Identities = 50/210 (23%), Positives = 86/210 (40%), Gaps = 41/210 (19%)

Query: 4   PILRLDHISAT-IGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNV 62
            ++ + ++S T  GG   L+DV L I   E + ++G +G+GKSTLL+   G+ +P SG +
Sbjct: 2   MMIEVKNLSKTYPGGHQALKDVNLEINQGEMVAIIGPSGAGKSTLLRSLNGLVDPTSGEI 61

Query: 63  FLHSSS--------------RLGYLEQN----PDLSHFSTISQYIDDTI----------- 93
             +                  +G + Q     P LS    +                   
Sbjct: 62  LFNGVQITKLKGKELRKLRRDIGMIFQQFNLVPRLSVLENVLLGRLGYTSTWRSLFGLFS 121

Query: 94  -KDTIEAPYSPYSLLKKFNLREQ--DRIENLSVGQTRCVALMKMLISRPDILILDEPTNH 150
            +D  +A       L++  + ++   R   LS GQ + VA+ + L+ +P I++ DEP   
Sbjct: 122 KEDKAQA----LDALERVGILDKAYQRASTLSGGQQQRVAIARALVQQPKIILADEPVAS 177

Query: 151 LDFRTIHWMEQELLKIN----SALIFVSHD 176
           LD  +   +   L  IN      +I   H 
Sbjct: 178 LDPESAKKVMDILKDINQEDGITVIVNLHQ 207