RPSBLAST alignment for GI: 254781123 and conserved domain: COG3845

>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only]. Length = 501
 Score = 57.9 bits (140), Expect = 8e-09
 Identities = 47/220 (21%), Positives = 90/220 (40%), Gaps = 38/220 (17%)

Query: 4   PILRLDHIS-ATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNV 62
            +L ++ +S     G+  ++DV   ++  E + + G  G+G+S L++  +G+ +P SG +
Sbjct: 256 VVLEVEDLSVKDRRGVTAVKDVSFEVRAGEIVGIAGVAGNGQSELVEAISGLRKPASGRI 315

Query: 63  FLHS---------------------SSRLGY-------LEQNPDLSHFSTISQYIDDTIK 94
            L+                        R G+       L +N  L             + 
Sbjct: 316 LLNGKDVLGRLSPRERRRLGLAYVPEDRHGHGLVLDLSLAENLVLGRHDKKPFSRGGFLD 375

Query: 95  -DTIEAPYSPYSLLKKFNLR---EQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNH 150
              I        L+++F++R         +LS G  + + L + L  RPD+LI  +PT  
Sbjct: 376 RRAIRKFAR--ELIEEFDVRAPSPDAPARSLSGGNQQKLILARELARRPDLLIAAQPTRG 433

Query: 151 LDFRTIHWMEQELLKI---NSALIFVSHDRRFLETLSTTT 187
           LD   I ++ + LL++     A++ +S D   +  LS   
Sbjct: 434 LDVGAIEFIHERLLELRDAGKAVLLISEDLDEILELSDRI 473