RPSBLAST alignment for GI: 254781123 and conserved domain: COG4148

>gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 352
 Score = 68.4 bits (167), Expect = 6e-12
 Identities = 55/170 (32%), Positives = 79/170 (46%), Gaps = 20/170 (11%)

Query: 315 IVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSG 374
           + GP+G+GKT+L+ ++ G  +PD G I L  N ++    +K   + P+K    Y+   + 
Sbjct: 29  LFGPSGSGKTSLINMIAGLTRPDEGRIEL--NGRVLVDAEKGIFLPPEKRRIGYVFQDAR 86

Query: 375 --DSLMVRGESRHVAGYIKDFLFHPDQAHSLM----------KHLSGGEKMRAIVARVLA 422
                 VRG  R+  G  K      DQ  +L+            LSGGEK R  + R L 
Sbjct: 87  LFPHYTVRGNLRY--GMWKSMRAQFDQLVALLGIEHLLDRYPGTLSGGEKQRVAIGRALL 144

Query: 423 QPFNFLIMDEPTNDLDF----ETLDFLERTITQLQGTILIVSHDRDFLDR 468
                L+MDEP   LD     E L +LER   ++   IL VSH  D + R
Sbjct: 145 TAPELLLMDEPLASLDLPRKREILPYLERLRDEINIPILYVSHSLDEVLR 194