RPSBLAST alignment for GI: 254781123 and conserved domain: COG4586

>gnl|CDD|34224 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 325
 Score = 91.1 bits (226), Expect = 9e-19
 Identities = 70/295 (23%), Positives = 114/295 (38%), Gaps = 50/295 (16%)

Query: 300 VKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDI 359
           V+D S  I  GE +G +G NGAGK+T LK+LTG + P  G +      ++   D  R   
Sbjct: 40  VQDISFEIPKGEIVGFLGANGAGKSTTLKMLTGLLLPTSGKV------RVNGKDPFRRRE 93

Query: 360 DPDKSLASYLTGSSG--------DSLMVRGESRHVAGY--------------IKDFLFHP 397
           +  +S+   +             DSL V      +                 ++ FL  P
Sbjct: 94  EYLRSIGLVMGQKLQLWWDLPALDSLEVLKLIYEIPDDEFAERLDFLTEILDLEGFLKWP 153

Query: 398 DQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFET----LDFLERTITQLQ 453
                 ++ LS G++MRA +A  L  P   L +DEPT  LD        +FL+    + Q
Sbjct: 154 ------VRKLSLGQRMRAELAAALLHPPKVLFLDEPTVGLDVNAQANIREFLKEYNEERQ 207

Query: 454 GTILIVSHDRDFLDRTVTSTI---AAQNIED-PNGYWIKYAGGYSDMLVQQKKSHPTPQK 509
            T+L+ +H  D +       +     Q + D       +  G Y +  V+ K++      
Sbjct: 208 ATVLLTTHIFDDIATLCDRVLLIDQGQLVFDGTLAQLQEQFGPYKEFSVELKQAKSLS-- 265

Query: 510 KNPPAQSLQEETVKKEKKQKRKNRLS-YSQKLLLERLPQEIHKIQLKITEKEQQI 563
                Q      V  E+    KN +S      ++ +L  E     L + + E + 
Sbjct: 266 -----QLALLGDVTIEEGLNIKNDVSREESADIIAKLLAEFEVRDLTVEDPEIED 315