RPSBLAST alignment for GI: 254781123 and conserved domain: COG4778

>gnl|CDD|34390 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235
 Score = 64.2 bits (156), Expect = 1e-10
 Identities = 54/189 (28%), Positives = 90/189 (47%), Gaps = 24/189 (12%)

Query: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL---GTNLKIATIDQK 355
           V+++ SL ++ GEC+ + GP+G+GK+TLL+ L     PD G I +   G  + + T  + 
Sbjct: 26  VLRNVSLSVNAGECVVLHGPSGSGKSTLLRSLYANYLPDEGQILVRHEGEWVDLVTA-EP 84

Query: 356 REDIDPDKSLASYLT------------GSSGDSLMVRGESRHVA-GYIKDFLFH---PDQ 399
           RE ++  ++   Y++                + L+ RG  R VA     D L     P++
Sbjct: 85  REVLEVRRTTIGYVSQFLRVIPRVSALDVVAEPLLARGVPREVARAKAADLLTRLNLPER 144

Query: 400 AHSLM-KHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTI--TQLQGTI 456
             SL     SGGE+ R  +AR     +  L++DEPT  LD      +   I   + +G  
Sbjct: 145 LWSLAPATFSGGEQQRVNIARGFIVDYPILLLDEPTASLDATNRAVVVELIREAKARGAA 204

Query: 457 LI-VSHDRD 464
           L+ + HD +
Sbjct: 205 LVGIFHDEE 213