RPSBLAST alignment for GI: 254781123 and conserved domain: KOG0056

>gnl|CDD|35279 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism]. Length = 790
 Score = 62.7 bits (152), Expect = 3e-10
 Identities = 50/196 (25%), Positives = 92/196 (46%), Gaps = 21/196 (10%)

Query: 285 LEADKITKQYDDRL-VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL 343
           +E   +T  YD    V+ D S  +  G+ + +VGP+GAGK+T+++LL      + G IT+
Sbjct: 538 IEFSNVTFAYDPGKPVLSDISFTVQPGKTVALVGPSGAGKSTIMRLLFRFFDVNSGSITI 597

Query: 344 -GTNLKIATIDQKREDID--PDKSL---------ASYLTGSSGDSLMVRGESRHVAGYIK 391
            G +++  T    R  I   P  ++           Y   S+ +  +    +   A    
Sbjct: 598 DGQDIRNVTQSSLRSSIGVVPQDTVLFNDTILYNIRYAKPSASNEEVY--AAAKAAQIHD 655

Query: 392 DFLFHPDQAHSLMKH----LSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLER 447
             L  P+  ++ +      LSGGEK R  +AR + +  + +++DE T+ LD  T   ++ 
Sbjct: 656 RILQFPEGYNTRVGERGLKLSGGEKQRVAIARTILKAPSIILLDEATSALDTNTERAIQA 715

Query: 448 TITQLQG--TILIVSH 461
            + +L    T ++V+H
Sbjct: 716 ALARLCANRTTIVVAH 731