RPSBLAST alignment for GI: 254781123 and conserved domain: KOG0065

>gnl|CDD|35288 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1391
 Score = 53.7 bits (129), Expect = 2e-07
 Identities = 58/242 (23%), Positives = 89/242 (36%), Gaps = 72/242 (29%)

Query: 20   LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAA-----GITE--------PQSGNVFLHS 66
            LL +V  + KP     L+G +G+GK+TLL + A     G  E        P+    F   
Sbjct: 806  LLNNVSGAFKPGVLTALMGESGAGKTTLLDVLAGRKTGGYIEGDILISGFPKDQETFARV 865

Query: 67   SSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKK--------------FNL 112
            S   GY+EQ     H   +      T+++++   +S    L K                L
Sbjct: 866  S---GYVEQQDI--HSPEL------TVRESLR--FSAALRLPKEVSDEEKYEYVEEVIEL 912

Query: 113  REQDRIEN---------LSVGQTRCVALMKMLISRPD-ILILDEPTNHLDFRTIHWMEQE 162
             E     +         LS  Q + + +   L++ P  IL LDEPT+ LD +    +   
Sbjct: 913  LELKEYADALVGLPGSGLSTEQRKRLTIGVELVANPSSILFLDEPTSGLDSQAA-AIVMR 971

Query: 163  LLK------------IN--SALIFVSHDRRFLETLSTTTVW---LDRGCLHHLDQGFAYF 205
             L+            I+  S  IF + D   L      TV+   L       ++    YF
Sbjct: 972  FLRKLADTGQTILCTIHQPSIDIFEAFDELLLLKRGGQTVYFGPLGENSSKLIE----YF 1027

Query: 206  ES 207
            ES
Sbjct: 1028 ES 1029