RPSBLAST alignment for GI: 254781123 and conserved domain: KOG0066

>gnl|CDD|35289 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis]. Length = 807
 Score =  138 bits (349), Expect = 4e-33
 Identities = 137/513 (26%), Positives = 223/513 (43%), Gaps = 59/513 (11%)

Query: 6   LRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAG------------ 53
           +++++   +  G  L  +  L+I    R  LVG NG GK+TLLK  A             
Sbjct: 265 IKIENFDISAQGKLLFVNASLTIVYGRRYGLVGPNGMGKTTLLKHIAARALAIPPNIDVL 324

Query: 54  -------ITEPQSGNVFLHSSS-RLGYLEQNPDL-SHFSTISQYIDDTIKDTIE-----A 99
                       + +  L +   RL  LE+   L S          + +K+  +      
Sbjct: 325 LCEQEVVADSTSAIDTVLKADKKRLALLEEEAKLMSQIEEGDTTAAERLKEVADELRAIG 384

Query: 100 PYSPYSLLKK------FNLREQDR-IENLSVGQTRCVALMKMLISRPDILILDEPTNHLD 152
             S  +  ++      F+   Q+R     S G    V+L + L   P +L+LDEPTNHLD
Sbjct: 385 ADSAEARARRILAGLGFSKEMQERPTTKFSGGWRMRVSLARALFLEPTLLMLDEPTNHLD 444

Query: 153 FRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNI 212
              + W++  L      L+ VSHD+ FL+++ T  + LD   LH+    +  F   KK  
Sbjct: 445 LNAVIWLDNYLQGWKKTLLIVSHDQGFLDSVCTDIIHLDNQKLHYYRGNYTLF---KKMY 501

Query: 213 LQQEQIRYHNLKKKNEAEKEWLRYGVTARR-----KRNVRRVKELHEIQKQLQEQ----- 262
            Q+ Q    N +K+ +  KE    G +A++     K  + R ++    + Q  ++     
Sbjct: 502 AQKMQEHEKNYEKQEKQLKELKAEGKSAKQAEKQVKEQLTRKQKKGGKKNQNDDEDAGAP 561

Query: 263 ---KKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVV-KDFSLRIHYGECIGIVGP 318
              ++    +++            VL    +T  Y  +  + K     I     I IVGP
Sbjct: 562 ELLQRPKEYSVKFQFPEPTKLNPPVLGLHDVTFGYPGQKPLFKKLDFGIDMDSRIAIVGP 621

Query: 319 NGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKR-EDIDPDKSLASYLTGSSGDSL 377
           NG GK+TLLKLL GK+ P+ G +     L+I   DQ   E ++ +++   YL        
Sbjct: 622 NGVGKSTLLKLLIGKLDPNDGELRKNHRLRIGWFDQHANEALNGEETPVEYLQRKFN--- 678

Query: 378 MVRGESRHVAGYIKDFLFHPDQAHSL-MKHLSGGEKMRAIVARVLAQPFNFLIMDEPTND 436
           +   E+R   G           AH++ +K LSGG+K R  +A +     + LI+DEPTN+
Sbjct: 679 LPYQEARKQLGTFG----LASHAHTIKIKDLSGGQKARVALAELALGGPDVLILDEPTNN 734

Query: 437 LDFETLDFLERTITQLQGTILIVSHDRDFLDRT 469
           LD E++D L   I +  G +++VSHD   +  T
Sbjct: 735 LDIESIDALAEAINEYNGGVIMVSHDERLIVET 767