RPSBLAST alignment for GI: 254781123 and conserved domain: KOG0066

>gnl|CDD|35289 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis]. Length = 807
 Score = 87.1 bits (215), Expect = 1e-17
 Identities = 73/235 (31%), Positives = 113/235 (48%), Gaps = 42/235 (17%)

Query: 1   MSLPILRLDHISATIGGID-LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQS 59
           ++ P+L L  ++    G   L + +   I    RI +VG NG GKSTLLK+  G  +P  
Sbjct: 582 LNPPVLGLHDVTFGYPGQKPLFKKLDFGIDMDSRIAIVGPNGVGKSTLLKLLIGKLDPND 641

Query: 60  GNVFLHSSSRLGYLEQ--NPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQD- 116
           G +  +   R+G+ +Q  N  L+   T  +Y                 L +KFNL  Q+ 
Sbjct: 642 GELRKNHRLRIGWFDQHANEALNGEETPVEY-----------------LQRKFNLPYQEA 684

Query: 117 ----------------RIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWME 160
                           +I++LS GQ   VAL ++ +  PD+LILDEPTN+LD  +I  + 
Sbjct: 685 RKQLGTFGLASHAHTIKIKDLSGGQKARVALAELALGGPDVLILDEPTNNLDIESIDALA 744

Query: 161 QELLKINSALIFVSHDRRFL-ETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQ 214
           + + + N  +I VSHD R + ET     V  ++G    +D+    FE +KK +L 
Sbjct: 745 EAINEYNGGVIMVSHDERLIVETDCNLWVVENQG----IDEIDGDFEDYKKEVLD 795