RPSBLAST alignment for GI: 254781123 and conserved domain: KOG2355

>gnl|CDD|37566 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only, Transcription]. Length = 291
 Score = 50.4 bits (120), Expect = 2e-06
 Identities = 60/255 (23%), Positives = 103/255 (40%), Gaps = 27/255 (10%)

Query: 20  LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAG--ITEPQSGNVFLHSSSRLGYLEQNP 77
           +  D  L +    R  LVG NG+GK+TLLKI +G  +       V   S+     LE + 
Sbjct: 29  IFFDFNLDLPAGSRCLLVGANGAGKTTLLKILSGKHMVGGGVVQVLGRSAFHDTSLESSG 88

Query: 78  DLSHFST-----------ISQYIDDTIKDTIEA-----PYSPYSLLKKFNLREQDRIENL 121
           DLS+              +    D + +  I       P     L+   ++  + R+  +
Sbjct: 89  DLSYLGGEWSKTVGIAGEVPLQGDISAEHMIFGVGGDDPERREKLIDILDIDLRWRMHKV 148

Query: 122 SVGQTRCVALMKMLISRPDILILDEPTNHLDF----RTIHWMEQELLKINSALIFVSHDR 177
           S GQ R V +   L+    +L+LDE T  LD       + ++++E  +  + +++ +H  
Sbjct: 149 SDGQRRRVQICMGLLKPFKVLLLDEVTVDLDVLARADLLEFLKEECEQRGATIVYATHIF 208

Query: 178 RFLETLSTTTVWLDRGCLHHL-----DQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKE 232
             LET  T  V++  G L         + F+   +    +    +    N KK  + +K 
Sbjct: 209 DGLETWPTHLVYIKSGKLVDNLKYQKIKEFSTSPNLLSTVESWLRKENKNNKKTRKEKKN 268

Query: 233 WLRYGVTARRKRNVR 247
            L   V    KR+ R
Sbjct: 269 SLHPPVLESLKRSSR 283