RPSBLAST alignment for GI: 254781123 and conserved domain: cd03217

>gnl|CDD|72976 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.. Length = 200
 Score = 70.9 bits (174), Expect = 1e-12
 Identities = 46/179 (25%), Positives = 81/179 (45%), Gaps = 27/179 (15%)

Query: 295 DDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTG--KIKPDCGFITL-GTNLKIAT 351
             + ++K  +L I  GE   ++GPNG+GK+TL K + G  K +   G I   G ++    
Sbjct: 11  GGKEILKGVNLTIKKGEVHALMGPNGSGKSTLAKTIMGHPKYEVTEGEILFKGEDIT--- 67

Query: 352 IDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGE 411
                 D+ P++     +  +      + G          DFL        + +  SGGE
Sbjct: 68  ------DLPPEERARLGIFLAFQYPPEIPGVK------NADFL------RYVNEGFSGGE 109

Query: 412 KMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG---TILIVSHDRDFLD 467
           K R  + ++L    +  I+DEP + LD + L  +   I +L+    ++LI++H +  LD
Sbjct: 110 KKRNEILQLLLLEPDLAILDEPDSGLDIDALRLVAEVINKLREEGKSVLIITHYQRLLD 168