RPSBLAST alignment for GI: 254781123 and conserved domain: cd03218

>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.. Length = 232
 Score = 87.5 bits (217), Expect = 1e-17
 Identities = 59/193 (30%), Positives = 98/193 (50%), Gaps = 18/193 (9%)

Query: 285 LEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL- 343
           L A+ ++K+Y  R VV   SL +  GE +G++GPNGAGKTT   ++ G +KPD G I L 
Sbjct: 1   LRAENLSKRYGKRKVVNGVSLSVKQGEIVGLLGPNGAGKTTTFYMIVGLVKPDSGKILLD 60

Query: 344 GTNLKIATIDQKRED----IDPDKSLASYLTGSSGDSLMVRGESRHVAGY-----IKDFL 394
           G ++    + ++       +  + S+   LT    ++++   E R ++       +++ L
Sbjct: 61  GQDITKLPMHKRARLGIGYLPQEASIFRKLTVE--ENILAVLEIRGLSKKEREEKLEELL 118

Query: 395 --FHPDQ-AHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQ 451
             FH      S    LSGGE+ R  +AR LA    FL++DEP   +D   +  +++ I  
Sbjct: 119 EEFHITHLRKSKASSLSGGERRRVEIARALATNPKFLLLDEPFAGVDPIAVQDIQKIIKI 178

Query: 452 LQGT---ILIVSH 461
           L+     +LI  H
Sbjct: 179 LKDRGIGVLITDH 191