RPSBLAST alignment for GI: 254781123 and conserved domain: cd03229

>gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 178
 Score =  102 bits (255), Expect = 4e-22
 Identities = 56/190 (29%), Positives = 93/190 (48%), Gaps = 30/190 (15%)

Query: 285 LEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLG 344
           LE   ++K+Y  + V+ D SL I  GE + ++GP+G+GK+TLL+ + G  +PD G I + 
Sbjct: 1   LELKNVSKRYGQKTVLNDVSLNIEAGEIVALLGPSGSGKSTLLRCIAGLEEPDSGSILID 60

Query: 345 TNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDF-LF-HPDQAHS 402
                  +    +++ P +                    R +    +DF LF H     +
Sbjct: 61  G----EDLTDLEDELPPLR--------------------RRIGMVFQDFALFPHLTVLEN 96

Query: 403 LMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG----TILI 458
           +   LSGG++ R  +AR LA   + L++DEPT+ LD  T   +   +  LQ     T+++
Sbjct: 97  IALGLSGGQQQRVALARALAMDPDVLLLDEPTSALDPITRREVRALLKSLQAQLGITVVL 156

Query: 459 VSHDRDFLDR 468
           V+HD D   R
Sbjct: 157 VTHDLDEAAR 166