RPSBLAST alignment for GI: 254781123 and conserved domain: cd03238

>gnl|CDD|72997 cd03238, ABC_UvrA, The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 176
 Score = 42.5 bits (100), Expect = 3e-04
 Identities = 39/176 (22%), Positives = 68/176 (38%), Gaps = 39/176 (22%)

Query: 300 VKDFSLRIHYGECIGIVGPNGAGKTTLLK--LLTGKIKPDCGFITLGTNLKIATIDQKRE 357
           +++  + I     + + G +G+GK+TL+   L          F+   +  K+  IDQ + 
Sbjct: 11  LQNLDVSIPLNVLVVVTGVSGSGKSTLVNEGLYASGKARLISFLPKFSRNKLIFIDQLQF 70

Query: 358 DIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIV 417
            ID          G                GY+        Q    +  LSGGE  R  +
Sbjct: 71  LID---------VG---------------LGYLT-----LGQK---LSTLSGGELQRVKL 98

Query: 418 ARVLAQPF--NFLIMDEPTNDLDFETLD-FLE--RTITQLQGTILIVSHDRDFLDR 468
           A  L         I+DEP+  L  + ++  LE  + +  L  T++++ H+ D L  
Sbjct: 99  ASELFSEPPGTLFILDEPSTGLHQQDINQLLEVIKGLIDLGNTVILIEHNLDVLSS 154