RPSBLAST alignment for GI: 254781123 and conserved domain: cd03245

>gnl|CDD|73004 cd03245, ABCC_bacteriocin_exporters, ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.. Length = 220
 Score =  100 bits (251), Expect = 1e-21
 Identities = 61/202 (30%), Positives = 100/202 (49%), Gaps = 26/202 (12%)

Query: 18  IDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHS----------- 66
           I  L +V L+I+  E++ ++G  GSGKSTLLK+ AG+ +P SG+V L             
Sbjct: 17  IPALDNVSLTIRAGEKVAIIGRVGSGKSTLLKLLAGLYKPTSGSVLLDGTDIRQLDPADL 76

Query: 67  SSRLGYLEQNPDLSHFSTISQYI--------DDTIKDTIE-APYSPYSLL--KKFNLREQ 115
              +GY+ Q+  L  + T+   I        D+ I    E A  + +        +L+  
Sbjct: 77  RRNIGYVPQDVTL-FYGTLRDNITLGAPLADDERILRAAELAGVTDFVNKHPNGLDLQIG 135

Query: 116 DRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQEL--LKINSALIFV 173
           +R   LS GQ + VAL + L++ P IL+LDEPT+ +D  +   +++ L  L  +  LI +
Sbjct: 136 ERGRGLSGGQRQAVALARALLNDPPILLLDEPTSAMDMNSEERLKERLRQLLGDKTLIII 195

Query: 174 SHDRRFLETLSTTTVWLDRGCL 195
           +H    L  L    + +D G +
Sbjct: 196 THRPSLL-DLVDRIIVMDSGRI 216