RPSBLAST alignment for GI: 254781123 and conserved domain: cd03259

>gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 213
 Score =  104 bits (261), Expect = 7e-23
 Identities = 57/209 (27%), Positives = 95/209 (45%), Gaps = 19/209 (9%)

Query: 6   LRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLH 65
           L L  +S T G +  L D+ L+++P E + L+G +G GK+TLL++ AG+  P SG + + 
Sbjct: 1   LELKGLSKTYGSVRALDDLSLTVEPGEFLALLGPSGCGKTTLLRLIAGLERPDSGEILID 60

Query: 66  SSS---------RLGYLEQNPDLSHFSTISQYID------DTIKDTIEAPYSPYSLLKKF 110
                        +G + Q+  L    T+++ I          K  I A       L   
Sbjct: 61  GRDVTGVPPERRNIGMVFQDYALFPHLTVAENIAFGLKLRGVPKAEIRARVRELLELVGL 120

Query: 111 NLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSAL 170
                     LS GQ + VAL + L   P +L+LDEP + LD +    + +EL ++   L
Sbjct: 121 EGLLNRYPHELSGGQQQRVALARALAREPSLLLLDEPLSALDAKLREELREELKELQREL 180

Query: 171 ----IFVSHDRRFLETLSTTTVWLDRGCL 195
               I+V+HD+     L+     ++ G +
Sbjct: 181 GITTIYVTHDQEEALALADRIAVMNEGRI 209