RPSBLAST alignment for GI: 254781123 and conserved domain: cd03264

>gnl|CDD|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 211
 Score = 83.3 bits (206), Expect = 2e-16
 Identities = 59/220 (26%), Positives = 99/220 (45%), Gaps = 39/220 (17%)

Query: 6   LRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLH 65
           L+L++++   G    L  V L++       L+G NG+GK+TL++I A +T P SG + + 
Sbjct: 1   LQLENLTKRYGKKRALDGVSLTL-GPGMYGLLGPNGAGKTTLMRILATLTPPSSGTIRID 59

Query: 66  SSS----------RLGYLEQNPD----------LSHFSTISQYIDDTIKDTIEAPYSPYS 105
                        R+GYL Q             L + + +       +K  ++       
Sbjct: 60  GQDVLKQPQKLRRRIGYLPQEFGVYPNFTVREFLDYIAWLKGIPSKEVKARVDE------ 113

Query: 106 LLKKFNL--REQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLD------FRTIH 157
           +L+  NL  R + +I +LS G  R V + + L+  P ILI+DEPT  LD      FR   
Sbjct: 114 VLELVNLGDRAKKKIGSLSGGMRRRVGIAQALVGDPSILIVDEPTAGLDPEERIRFRN-- 171

Query: 158 WMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHH 197
            +  EL + +  +I  +H    +E+L      L++G L  
Sbjct: 172 -LLSELGE-DRIVILSTHIVEDVESLCNQVAVLNKGKLVF 209