RPSBLAST alignment for GI: 254781123 and conserved domain: cd03369

>gnl|CDD|73061 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.. Length = 207
 Score = 57.6 bits (139), Expect = 9e-09
 Identities = 48/169 (28%), Positives = 81/169 (47%), Gaps = 15/169 (8%)

Query: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKRED 358
           V+K+ S ++  GE IGIVG  GAGK+TL+  L   ++ + G I +   + I+TI  +   
Sbjct: 23  VLKNVSFKVKAGEKIGIVGRTGAGKSTLILALFRFLEAEEGKIEI-DGIDISTIPLED-- 79

Query: 359 IDPDKSLASYLTGSSGDSLMVRGESRH----VAGYIKDFLFHPDQAHSLMKHLSGGEKMR 414
                 L S LT    D  +  G  R        Y  + ++   +      +LS G++  
Sbjct: 80  ------LRSSLTIIPQDPTLFSGTIRSNLDPFDEYSDEEIYGALRVSEGGLNLSQGQRQL 133

Query: 415 AIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQL--QGTILIVSH 461
             +AR L +    L++DE T  +D+ T   +++TI +     TIL ++H
Sbjct: 134 LCLARALLKRPRVLVLDEATASIDYATDALIQKTIREEFTNSTILTIAH 182