BLAST/BLAST alignment of GI: 254781123 and GI: 254780273
>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539
 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%)

Query: 282 KLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFI 341
           K +     ++K +  + V+ D +L  +    IGI+GPNGAGK+T+L+++ G  K   G  
Sbjct: 4   KFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEA 63

Query: 342 TLGTNLKIATIDQK 355
            L T   +  + Q+
Sbjct: 64  WLATGFTVGYLPQE 77