BLAST/BLAST alignment of GI: 254781123 and GI: 254780340
>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348
 Score = 40.0 bits (92), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 77/188 (40%), Gaps = 45/188 (23%)

Query: 26  LSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTI 85
           L +K  E + L+G +G+GKSTLL+   G+     G V + +    G++  NP    ++  
Sbjct: 50  LEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDK--GFV--NP----YAAD 101

Query: 86  SQYIDDTIKDTIEAPYSPYSLL----------------------KKFNLREQDRIENL-- 121
           +  +      T+   +  ++LL                      +K  + E   I NL  
Sbjct: 102 ANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTK 161

Query: 122 ---------SVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELL----KINS 168
                    S G  + V   +   +   IL++DEP + LD      ++ ELL    K+  
Sbjct: 162 WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221

Query: 169 ALIFVSHD 176
            ++FVSHD
Sbjct: 222 TIVFVSHD 229