BLAST/BLAST alignment of GI: 254781123 and GI: 254780538
>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280
 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 97/216 (44%), Gaps = 28/216 (12%)

Query: 6   LRLDHISATI-GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFL 64
           L L  IS T   G   L+DV L I       L+G NG+GKSTL +   G+     G++ +
Sbjct: 12  LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71

Query: 65  HSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIE----------------APYSPYSLLK 108
            + +    L+   DL  +   ++ ID T    +E                A  + Y ++ 
Sbjct: 72  FNQTVENALK--ADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVT 129

Query: 109 K------FNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRT---IHWM 159
           +       +   Q +I  LS+GQ + V L + L  +  ++I+DEP   +DF+T   + ++
Sbjct: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189

Query: 160 EQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCL 195
            + LL  +  ++  +H+   + +    T++L +  L
Sbjct: 190 LKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVL 225