BLAST/BLAST alignment of GI: 254781123 and GI: 254780576
>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597
 Score = 40.4 bits (93), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 82/180 (45%), Gaps = 18/180 (10%)

Query: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL-GTNLKIATIDQKRE 357
           + K  S  I   +   ++G +G GK+T+ KLL        G IT+ G ++K  T +  R+
Sbjct: 372 IFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQ 431

Query: 358 DID--PDKSLA-------SYLTGSSGDSLMVRGESRHVAGYIKDFLFH-PDQAHSLMKH- 406
            I   P  ++        + L G+   S      +  VA  +K F+   P+   +++   
Sbjct: 432 TIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQ-LKSFIMKLPNGYDTVVGER 490

Query: 407 ---LSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG--TILIVSH 461
              LSGGEK R  +AR + +    +I DE T+ LD  T   ++  +  L    T L+++H
Sbjct: 491 GLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVIAH 550