BLAST/BLAST alignment of GI: 254781123 and GI: 254780596
>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438
 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 77/168 (45%), Gaps = 22/168 (13%)

Query: 16  GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQ 75
           G + +L  V  ++   E + L+G +GSGKSTLL+I AG+  P SG V        G   +
Sbjct: 28  GNLLVLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPSSGQVLFK-----GKKIK 82

Query: 76  NP--DLS-HFSTISQYIDDTIKDTIEAPYSPYSL---------LKKFNLREQDRIEN--- 120
           +P  D+S  F T + +   T+ + +E       +         L   +L   D  E+   
Sbjct: 83  DPPKDISVVFQTFALFPWLTVLENVELGLKAKGIDKEERRKRALSAIDLIGLDGFESAHT 142

Query: 121 --LSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKI 166
             +S G  + V   +  +  P +L++DEP + LD  T   +  +L+ +
Sbjct: 143 TEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDVLTAENLRTDLIDL 190