RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >gnl|CDD|37232 KOG2021, KOG2021, KOG2021, Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure, Intracellular trafficking, secretion, and vesicular transport, Translation, ribosomal structure and biogenesis]. Length = 980 Score = 25.7 bits (56), Expect = 2.9 Identities = 9/34 (26%), Positives = 19/34 (55%) Query: 14 NQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIE 47 N++ +R VR F +++ + + P++ LIE Sbjct: 708 NKFENIRSAVRFTFHRMIPILGNKVLPFIPKLIE 741 >gnl|CDD|37518 KOG2307, KOG2307, KOG2307, Low density lipoprotein receptor [Intracellular trafficking, secretion, and vesicular transport]. Length = 705 Score = 24.6 bits (53), Expect = 6.9 Identities = 11/44 (25%), Positives = 18/44 (40%) Query: 22 EVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHI 65 +V + K + YV + PV+ KEG+ E + H Sbjct: 555 DVPRLYRWTNKEVPTTHSSYVVTALRPVKALKEGLKCELEQPHT 598 >gnl|CDD|88599 cd04823, ALAD_PBGS_aspartate_rich, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll. This reaction involves the formation of a Schiff base link between the substrate and the enzyme. PBGSs are metalloenzymes, some of which have a second, allosteric metal binding site, beside the metal ion binding site in their active site. Although PBGS is a family of homologous enzymes, its metal ion utilization at catalytic site varies between zinc and magnesium and/or potassium. PBGS can be classified into two groups based on differences in their active site metal binding site. All of PBGS_aspartate_rich contain an aspartate rich metal binding site with the general sequence DXALDX(Y/F)X3G(H/Q)DG. They also contain an allosteric magnesium binding sequence RX~164DX~65EXXXD and are activated by magnesium and/or potassium, but not by zinc. PBGSs_aspartate_rich are found in some bacterial species and photosynthetic organisms such as vascular plants, mosses and algae, but not in archaea.. Length = 320 Score = 24.3 bits (53), Expect = 8.0 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 16/61 (26%) Query: 1 MNPHGLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEG 60 NP L+ R +R ++ AFP++ + AL+PY G +G+V +G Sbjct: 90 YNPDNLVC--------RAIRA-IKEAFPELGIITDVALDPYTSH-------GHDGIVRDG 133 Query: 61 Y 61 Sbjct: 134 G 134 >gnl|CDD|48119 cd03192, GST_C_Sigma_like, GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Vertebrate class Sigma GSTs are characterized as GSH-dependent hematopoietic prostaglandin (PG) D synthases and are responsible for the production of PGD2 by catalyzing the isomerization of PGH2. The functions of PGD2 include the maintenance of body temperature, inhibition of platelet aggregation, bronchoconstriction, vasodilation, and mediation of allergy and inflammation. Other class Sigma members include the class II insect GSTs, S-crystallins from cephalopods, nematode-specific GSTs, and 28-kDa GSTs from parasitic flatworms. Drosophila GST2 is associated with indirect flight muscle and exhibits preference for catalyzing GSH conjugation to lipid peroxidation products, indicating an anti-oxidant role. S-crystallin constitutes the major lens protein in cephalopod eyes and is responsible for lens transparency and proper refractive index. The 28-kDa GST from Schistosoma is a multifunctional enzyme, exhibiting GSH transferase, GSH peroxidase, and PGD2 synthase activities, and may play an important role in host-parasite interactions. Also members are novel GSTs from the fungus Cunninghamella elegans, designated as class Gamma, and from the protozoan Blepharisma japonicum, described as a light-inducible GST.. Length = 104 Score = 24.1 bits (52), Expect = 9.3 Identities = 9/36 (25%), Positives = 16/36 (44%) Query: 4 HGLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALE 39 Y + ++ ++ A PK LK +EK L+ Sbjct: 21 AKYFYEKDGEEKKEKKKEFLKEAIPKYLKKLEKILK 56 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.137 0.398 Gapped Lambda K H 0.267 0.0479 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,198,594 Number of extensions: 53628 Number of successful extensions: 120 Number of sequences better than 10.0: 1 Number of HSP's gapped: 119 Number of HSP's successfully gapped: 14 Length of query: 101 Length of database: 6,263,737 Length adjustment: 68 Effective length of query: 33 Effective length of database: 4,794,325 Effective search space: 158212725 Effective search space used: 158212725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.0 bits)