RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 28.4 bits (62), Expect = 0.39 Identities = 6/19 (31%), Positives = 11/19 (57%), Gaps = 3/19 (15%) Query: 31 LKSIEKALEPYVD---PLI 46 LK ++ +L+ Y D P + Sbjct: 22 LKKLQASLKLYADDSAPAL 40 >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, APO, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Length = 90 Score = 26.3 bits (58), Expect = 1.8 Identities = 12/52 (23%), Positives = 27/52 (51%) Query: 7 MYAPKEGNQYRPLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVD 58 Y+ +EG+++ +KE++ K L K + + L+E ++ K+ V+ Sbjct: 18 KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVN 69 >3lig_A Fructosyltransferase; five bladed beta-propeller fold, hydrolase; 1.80A {Aspergillus japonicus} PDB: 3ldk_A* 3lem_A* 3ldr_A 3lih_A* 3lf7_A 3lfi_A* Length = 634 Score = 26.3 bits (57), Expect = 2.0 Identities = 3/24 (12%), Positives = 5/24 (20%), Gaps = 6/24 (25%) Query: 1 MN-PHGLMYAPKEGN-----QYRP 18 + P P G + Sbjct: 39 IGDPCAHYTDPSTGLFHVGFLHDG 62 >3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Score = 25.1 bits (54), Expect = 3.9 Identities = 12/57 (21%), Positives = 22/57 (38%) Query: 18 PLRKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDEGYRLHICALIKLLEN 74 LR V K+ +SIE L L+ ++ G+ + + L L+ + Sbjct: 5 FLRGTVEKEVTKVKQSIEDELIRSDSQLMNFPQLPSNGIPQDDVIEELNKLNDLIPH 61 >2hj0_A Putative citrate lyase, ALFA subunit; alpha beta protein., structural genomics, PSI-2, protein structure initiative; HET: CIT; 2.70A {Streptococcus mutans UA159} Length = 519 Score = 24.8 bits (54), Expect = 5.5 Identities = 10/37 (27%), Positives = 17/37 (45%) Query: 3 PHGLMYAPKEGNQYRPLRKEVRNAFPKILKSIEKALE 39 G + K + K V+ + K+L SI +A+E Sbjct: 21 FEGELAHIKSYKESSRQVKPVKPSDDKLLSSIHEAIE 57 >2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Length = 399 Score = 24.5 bits (52), Expect = 6.3 Identities = 7/19 (36%), Positives = 9/19 (47%) Query: 15 QYRPLRKEVRNAFPKILKS 33 Y LR E A ++L S Sbjct: 38 AYEELRAETDAAIARVLDS 56 >1xny_A Pccase, propionyl-COA carboxylase complex B subunit, PCC; polyketide, polyketide synthase, acyl-COA carboxylase, carboxyltransferase; HET: 191 BTN; 2.20A {Streptomyces coelicolor} SCOP: c.14.1.4 c.14.1.4 PDB: 1xnv_A* 1xo6_A 1xnw_A Length = 530 Score = 24.0 bits (51), Expect = 8.9 Identities = 13/61 (21%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Query: 20 RKEVRNAFPKILKSIEKALEPYVDPLIEPVEIGKEGMVDE-----GYRLHICALIKLLEN 74 R+ + +A + + ++ Y D L+ P + G VD R HI ++ L Sbjct: 456 RRTIADAGDDAEATRARLIQEYEDALLNPYTAAERGYVDAVIMPSDTRRHIVRGLRQLRT 515 Query: 75 R 75 + Sbjct: 516 K 516 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.315 0.137 0.398 Gapped Lambda K H 0.267 0.0619 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 858,325 Number of extensions: 35769 Number of successful extensions: 87 Number of sequences better than 10.0: 1 Number of HSP's gapped: 87 Number of HSP's successfully gapped: 13 Length of query: 101 Length of database: 5,693,230 Length adjustment: 66 Effective length of query: 35 Effective length of database: 4,093,126 Effective search space: 143259410 Effective search space used: 143259410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.3 bits)