RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781125|ref|YP_003065538.1| hypothetical protein CLIBASIA_05135 [Candidatus Liberibacter asiaticus str. psy62] (59 letters) >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT. This family consists of several bacterial cobalamin biosynthesis (CobT) proteins. CobT is involved in the transformation of precorrin-3 into cobyrinic acid. Length = 282 Score = 27.9 bits (62), Expect = 0.67 Identities = 11/43 (25%), Positives = 15/43 (34%), Gaps = 5/43 (11%) Query: 18 RLSAKDPHYNVIFRDEVPSFIYETLNIP-----ADKRKMAVIR 55 R A D V F + P +P A K A++R Sbjct: 21 RAIAGDKELEVAFAGDRPGLAGNRARLPELPKDASKTDAAIVR 63 >gnl|CDD|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional. Length = 1307 Score = 26.3 bits (58), Expect = 2.0 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Query: 20 SAKDPHYNVIFRDEVPSFIYETLNIPADKRKMAVIR 55 S K P + + F P+F + + K K+A+IR Sbjct: 1012 SRKAPTWKLSF---TPAFTDKKIMNATSKPKVAIIR 1044 >gnl|CDD|185621 PTZ00442, PTZ00442, sexual stage antigen s48/45-like protein; Provisional. Length = 347 Score = 25.6 bits (56), Expect = 2.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Query: 25 HYNVIFRDEVPSFIYETLN 43 HYN F VPS IY+ + Sbjct: 264 HYNKTFYARVPSRIYQNMK 282 >gnl|CDD|184009 PRK13370, mhpB, 3-(2,3-dihydroxyphenyl)propionate dioxygenase; Provisional. Length = 313 Score = 24.9 bits (55), Expect = 4.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Query: 25 HYNVIFRDEVPSF 37 HYN F D +P F Sbjct: 53 HYNGFFYDVMPPF 65 >gnl|CDD|149197 pfam07982, Herpes_UL74, Herpes UL74 glycoproteins. Members of this family are viral glycoproteins that form part of an envelope complex. Length = 457 Score = 24.2 bits (52), Expect = 8.3 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 10 CLNDPNRYRLSAKDPHYNVIFRDEVPSFIYETLNI 44 C D NR +S + +V+ R+E P IY TL++ Sbjct: 344 CKPDRNRTAVSEFMKNTHVLIRNETPYTIYGTLDM 378 >gnl|CDD|184796 PRK14701, PRK14701, reverse gyrase; Provisional. Length = 1638 Score = 24.1 bits (52), Expect = 9.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Query: 16 RYRLSAKDPHYNVIFRDEVPSFIYETLNI 44 R K ++ IF D+V +F+ + NI Sbjct: 191 RNFPEMKHLKFDFIFVDDVDAFLKASKNI 219 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.141 0.426 Gapped Lambda K H 0.267 0.0691 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,004,008 Number of extensions: 46194 Number of successful extensions: 118 Number of sequences better than 10.0: 1 Number of HSP's gapped: 118 Number of HSP's successfully gapped: 11 Length of query: 59 Length of database: 5,994,473 Length adjustment: 31 Effective length of query: 28 Effective length of database: 5,324,625 Effective search space: 149089500 Effective search space used: 149089500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.1 bits)