BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781126|ref|YP_003065539.1| hypothetical protein
CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62]
         (85 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040803|gb|ACT57599.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 85

 Score =  132 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 85/85 (100%), Positives = 85/85 (100%)

Query: 1  MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK 60
          MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK
Sbjct: 1  MNIFVRDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYK 60

Query: 61 ARCKYRKESKLQKLSKSKIFSIKHT 85
          ARCKYRKESKLQKLSKSKIFSIKHT
Sbjct: 61 ARCKYRKESKLQKLSKSKIFSIKHT 85


>gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040661|gb|ACT57457.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 125

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 18  ITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYR 66
           ITR +  L +++KKAFF HEKKV  +LNYNA DRK NI++ Y+AR KYR
Sbjct: 65  ITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113


>gi|268323357|emb|CBH36945.1| probable phenylalanyl-tRNA synthetase, alpha chain [uncultured
           archaeon]
          Length = 527

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 6   RDISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKAR 62
           +D+   RALVF+I +G A +  D+ ++FF  +K+    +N+   ++ S IDK+ + R
Sbjct: 77  QDLPEKRALVFLIDKGRATV--DELQSFFDDDKESKIAINWLLRNKWSKIDKIGEER 131


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.319    0.137    0.370 

Lambda     K      H
   0.267   0.0434    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 825,439,516
Number of Sequences: 14124377
Number of extensions: 32001972
Number of successful extensions: 142959
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 142950
Number of HSP's gapped (non-prelim): 17
length of query: 85
length of database: 4,842,793,630
effective HSP length: 55
effective length of query: 30
effective length of database: 4,065,952,895
effective search space: 121978586850
effective search space used: 121978586850
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)
S2: 76 (33.8 bits)