RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) >gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase. This enzyme plays a role in gluconeogensis but not glycolysis. Length = 1143 Score = 26.7 bits (59), Expect = 1.6 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query: 1 MNIFVRDISCLRALVFVITRGVA-RLPKDQKKAFFRHEKKVADHLNY-NAG 49 +++F RD S R V+ A L ++ + + K+A +NY NAG Sbjct: 222 VHLFERDCSVQRRHQKVVEVAPAPYLSREVRDEIAEYAVKLAKAVNYINAG 272 >gnl|CDD|132563 TIGR03524, GldJ, gliding motility-associated lipoprotein GldJ. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldJ is a lipoprotein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae. Knockouts of GldJ abolish the gliding phenotype. GldJ is homologous to GldK. There is a GldJ homolog in Cytophaga hutchinsonii and several other species that has a different, shorter architecture and is represented by a separate model. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility. Length = 559 Score = 26.5 bits (58), Expect = 1.6 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Query: 17 VITRG----VARLPKDQKKAFFRHEKKVADHLNYNAGDRKS 53 V+ R +A++P D+ + + R +D+ N GD++S Sbjct: 413 VVARYLPGEIAQVPVDKNETYLRTNFSKSDNANIRDGDKQS 453 >gnl|CDD|130598 TIGR01535, glucan_glucosid, glucan 1,4-alpha-glucosidase. Glucan 1,4-alpha-glucosidase catalyzes the hydrolysis of terminal 1,4-linked alpha-D-glucose residues from non-reducing ends of polysaccharides, releasing a beta-D-glucose monomer. Some forms of this enzyme can hydrolyze terminal 1,6- and 1,3-alpha-D-glucosidic bonds in polysaccharides as well. Length = 648 Score = 25.6 bits (56), Expect = 3.2 Identities = 13/51 (25%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 7 DISCLRALVFVITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDK 57 D + ++ L F +T G + + + K + EK L Y + +N DK Sbjct: 21 DTADIKELKFAVTDGKSFVSDETKDTTSKVEKFTDKALAY----KLTNTDK 67 >gnl|CDD|153033 pfam12599, DUF3768, Protein of unknown function (DUF3768). This family of proteins is found in bacteria. Proteins in this family are typically between 108 and 129 amino acids in length. There are two conserved sequence motifs: NDP and RVLT. Length = 84 Score = 25.2 bits (56), Expect = 3.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 17 VITRGVARLPKDQKKAFFR 35 VIT+GVA L +D ++ R Sbjct: 1 VITQGVAALGEDDQQELLR 19 >gnl|CDD|185184 PRK15284, PRK15284, putative fimbrial outer membrane usher protein StfC; Provisional. Length = 881 Score = 25.2 bits (55), Expect = 4.3 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 6 RDISCLRALVFVITRGVARLPKD 28 RD++ A+ F +T +L KD Sbjct: 424 RDLALFGAVAFDVTHSHTKLDKD 446 >gnl|CDD|132697 TIGR03658, IsdH_HarA, haptoglobin-binding heme uptake protein HarA. HarA is a heme-binding NEAT-domain (NEAr Transporter, pfam05031) protein which has been shown to bind to the haptoglobin-hemoglobin complex in order to extract heme from it. HarA has also been reported to bind hemoglobin directly. HarA (also known as IsdH) contains three NEAT domains as well as a sortase A C-terminal signal for localization to the cell wall. The heme bound at the third of these NEAT domains has been shown to be transferred to the IsdA protein also localized at the cell wall, presumably through an additional specific protein-protein interaction. Haptoglobin is a hemoglobin carrier protein involved in scavenging hemoglobin in the blood following red blood cell lysis and targetting it to the liver. Length = 895 Score = 24.4 bits (52), Expect = 6.6 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Query: 37 EKKVADHLNYNAGDRKSNIDKLYKARCKYRKESKLQKLSKSKIF 80 +KK +HL D +DK K + K SK KLS+SK+ Sbjct: 821 DKKTTEHL---PSDIHKTVDKTVKTKEKAGTPSKENKLSQSKML 861 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.136 0.389 Gapped Lambda K H 0.267 0.0734 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,273,692 Number of extensions: 64174 Number of successful extensions: 166 Number of sequences better than 10.0: 1 Number of HSP's gapped: 165 Number of HSP's successfully gapped: 16 Length of query: 85 Length of database: 5,994,473 Length adjustment: 54 Effective length of query: 31 Effective length of database: 4,827,641 Effective search space: 149656871 Effective search space used: 149656871 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.0 bits)